Blogs I follow:

candiedmoonher-masterbellafrankensteinthe23rdfuckyeah1990swonderwomanzombiesinmemoryoflillyfuckyeahalternativehairprguitarman10knoteschubby-bunniescadneyinkiemamac0untessbathorygarbagekid666probablybutprobablynotzachcarson-drew-itdead-lovers-sarabandethatscienceguyretrogasmderpycatsonlycutechubbygirlsbettyfeloncultqueenmyspookywookyplacenudenerdsengage-with-zorppremierbonheurjacksacreagelittlegaywitchfuckyeahallhallowsevethekatticfuckyeahvintage-retrosighsleepycreepyyehasebastiancolumbinetwinhairbunsskyrimconfessionssfuturasatanaa-lolitas-lifedaddyvinniefuckyoulizprincegoddesurickisadickdoemilkweedporndailyvideov0mitpresident-hindenburglotsalipstickcreepygirlmousehair-dyepumpkinspiceandeverythingspookybunnyfoodtheniftyfiftiesdarksideoftheshroomdirtylittlelustfulgirldeadmoondreamshex-girlfriendmidwest-monsternevvermollysodacurveappealjustpetsblood-splattersoft-communismabbwlover4lifemikefailrorybbellowstiesssahorrorfetishfunkssnikkilipstickbootsnglitterkatdarcy83archiecomicshorrorharbourlittlebunnysunshinespaceghostzombieyourlilmermaidvintagegalbehindbobsburgerskyarychansugarpillcosmeticsveryspecialpornpastelbatsoyacidespankingtheatredonutguts365daysofhalloweenolderoticartweirdoextraordinairechessienessbruised-porcelaina1000daisiesgamegeek2589ceedlingsparklebatclementinerewindfeministprinc3sscuntbarfrosalarianborderlands-confessionsvicemagladywynterhorrordollsfatandnerdyprincess-peachiecinemassacreproductionsbehind-the-blowathousanddaisiesslayboybunnythe-blood-houndkinkykitfoxameliabutterfilthyporndirectedbychuckjonesraisa-allinsweetestlolitabigfatcherrybombfuneralhome420seibeijoshualeecossmtn-dueshnikklesrstevensfynewnewyorkmisssirenrubytulipsyulischeidtvalentinovampundressedskeletonarchiecoversneon-casketelderscrollsftwequalityformermaidstheclothespiletextsfromsuperheroesi-justreally-like-cats-okaytotallytransparentitsalwayssunnyinasgardsoda-floatmelliferousmouthrjdizzlemahnizzlehalloweenspastfuckyeahstrippershitplasticbatsgreatgrottujet-rinknicktaxidermyrickyskaggsjustwhoeverunderbustfourthdimensionalpenisrecordgroovesoriginalgameboyfunsuipastelhorrorsugar-honey-iced-teadailybunnyfattyvixentedbundysvictimtheheftyhideawayhappycolorfulhairghoulinterruptedthe-strange-catspookypukemoonbrainsbigbootyislandcartoon-lesbiansfuckyeahtarantinofilmsklaudiakellyfuture404everything-has-beautynaked-in-torontotreymattsuperfangirlkittiesntittiesenjoycocaineeddie--valentinobabydearrfuckyeahsouthparkgothkidsseriousartistneilcicieregamingdoylefuckyeah-diyadamworksadversumluctusfatfashionatroposxrcurvyleighthetorturedoctorneedlingsfyeahlouisckmerongcrossingcarlarodriguesartyour-funeralpaperbicyclecreativeautumnsdelightviolentsexmodestjunesequinedseaqueendrewpixeldarshanapathakfuckyeahlizlemonrosscottfuckyeahtorontocurvysuperslutslutslessonsbunnyhunsemmycfuckyeahnightmaresthegoblincaveghostbaberussianfamouscurvesarcherquotesrecursivedescentforestfluffgunshowcomicscooterstreambitter--bitchhisblackdresschubbiejunkieelliesteinigapeculiarmindpublicpeeksitsalwayssunnytimandericthetinybatpantsandburgerskatiekutthroattammytrashoclutteredwithgoldfloraeatsfaunaprettyplussizeantiquesquirrelpineneedlecollectiveradiomarupandaricanpixelvixenskellyoxfordmitchclembrodeep----comixfire-plugfashiontipsfromcomicstripspsfashionthingsformywifefuckyeaharchergifshellyeahcrossoversdirtystorytimemchanksarchivethreadbangeroursuperadventurejamilajacuzziaudfacedmeloravilletoridori69theprintfiendfatshionpeepshowelcolorlococollectshunsjephjacquesnooklingspace-coyotesaramlyonssodakicknailkandymarklittlecincofamilykamikeabigbootygifskrudmancherry-blogmidnitesurpriseprettygirlfoodiamdonaldtheinturnetexplorersilenthavenzombifytherealscumbagstevedvdpdoespapyrusbelonghereshay-it-aint-socaturdaycitycommandersarahssketchbooksumocycothediygirlthebobsburgerexperimentharebrainedstefinbangarangcatsthatlooklikepinupgirlsspookycomicsgambinogirlsrather-embarassedtaysticleagentlovermagic-catsbrotherbrainfgfscadetsthreewordphraseorleathajoy
July. 29. 2014. 11:11 am

"You *don’t* have Pizza Pops in your purse?"

July. 28. 2014. 07:44 pm 14 notes

Equipmonk

via rorybbellows
July. 28. 2014. 02:51 pm 61,572 notes

Bunny loaf

(Source: youtube.com)

via bunnyfood
July. 28. 2014. 02:02 pm 277,394 notes
Crescent

Crescent

via garbagekid666
July. 28. 2014. 01:53 pm 4,788 notes

Me and Leigh

(Source: spotyoubitch)

via garbagekid666
July. 28. 2014. 01:45 pm 149 notes

(Source: loving-him-was-blood-orange)

via gamegeek2589
July. 28. 2014. 01:18 pm 141 notes

Babespiration

via babydearr
July. 28. 2014. 01:17 pm 2,663 notes

I AM NOT TREATS

(Source: catsandhumanfoods)

via dead-lovers-sarabande
July. 28. 2014. 12:39 pm 79,931 notes

koikoikoi:

These photographs, by New York-based Bing Wright, feature reflections of sunsets in shattered mirrors.

This is a perfect visual representation of what nostalgia feels like

(Source: koikoikoi.com)

via garbagekid666
July. 28. 2014. 12:30 pm 21,657 notes
All vagina everything

All vagina everything

(Source: fancyadip)

via slayboybunny
July. 26. 2014. 10:41 pm 24,061 notes

I walk around Toronto like I’m Ramona

(Source: yeahmrwhites)

via 10knotes
July. 26. 2014. 10:32 pm 4,156 notes

softgrungecersei:

The bees in Candyman were bred specifically for the movie. They needed to make sure that the bees were only 12 hours old so that they looked like mature bees, but their stinger wouldn’t be powerful enough to do any real damage. Real bees were actually put into Tony Todd’s mouth while they where shooting the climax. His only protection was a mouth guard that kept him from having the bees go down his throat. Virginia Madsen is allergic to bees, so an ambulance was always on set while filming the bee sequence.

I miss this kinda movie dedication

via horrorharbour
July. 26. 2014. 10:20 pm 8,202 notes

Perfect evening

(Source: kittenishly)

via plasticbats
July. 26. 2014. 10:18 pm 46,369 notes

premierbonheur:

ravenfirethief:

wrongjohnsilver:

I knew I missed something in London!

Hoxton Street Monster Supplies exists.

YESSSS

(Source: wemadethis.co.uk)

via premierbonheur
July. 26. 2014. 10:14 pm 4,828 notes

Bitches get cut

(Source: tatianamaslnay)

via myspookywookyplace